PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp1071s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 370aa    MW: 42121.3 Da    PI: 5.002
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp1071s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.13.6e-14371151899
                          --HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  18 lpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          +p++f+++ gg + ++ ++++  + g   W vk+  ++ + +y +++GW eFv++n+L   D++vF+++  ++f+++vkvf+ 
  Kaladp1071s0001.1.p  37 VPRQFVRHLGGRPVGEYQMRVWGSAGsYCWIVKV--ERDGAEYCFKNGWPEFVEDNDLGYADVLVFSYE--EKFKFLVKVFDP 115
                          7*****888*9**********99888689*****..*******************************85..79999*****96 PP

2B345.41.5e-142703521398
                          TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                          ++ +++pk+ a e ++ ++++ +l+++d++ + W +kl+ +  +g++ lt+ W +F +++ LkegD++vF+++g++    +v++++
  Kaladp1071s0001.1.p 270 QHHMTIPKEIAVEKDLYSKSQSQLVVRDSKEKLWFMKLS-TAEDGSVNLTEKWASFYESHSLKEGDSCVFEFIGSRI--VHVQIIS 352
                          3559*******999666666679***************4.77778899***********************998444..4888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010199.6E-518116IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.7E-1436116IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-1436123IPR015300DNA-binding pseudobarrel domain
PfamPF023623.2E-1137114IPR003340B3 DNA binding domain
CDDcd100172.57E-1037114No hitNo description
PROSITE profilePS5086311.06837116IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-15255353IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.055258354IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.8E-15258354IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.6E-5261354IPR003340B3 DNA binding domain
CDDcd100172.38E-9270352No hitNo description
PfamPF023625.1E-12270352IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MQPAINRMQN LLLLRYHAKI SRNSPKTLHE IRLGSEVPRQ FVRHLGGRPV GEYQMRVWGS  60
AGSYCWIVKV ERDGAEYCFK NGWPEFVEDN DLGYADVLVF SYEEKFKFLV KVFDPSGLKR  120
NMPSLRGEEE EEEVAFETPL QSDGESEDGQ NMPMDFDEQP IFYVDEEGEC HVGAGGKRVQ  180
VSMETSHEES LCHMEVGGEK DKEGHGRMES TQKGSVGCSD MRGHGKVELT RKESLFWFED  240
KAKESIEERI APPLSSDRSR FIATWSSTWQ HHMTIPKEIA VEKDLYSKSQ SQLVVRDSKE  300
KLWFMKLSTA EDGSVNLTEK WASFYESHSL KEGDSCVFEF IGSRIVHVQI ISASNVMSHA  360
GVEDVLLRD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09780.11e-06B3 family protein